Lineage for d4i4tf2 (4i4t F:77-378)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541719Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 protein domains)
    Pfam PF03133; PubMed 22020298
  6. 2541720Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)
  7. 2541721Species Chicken (Gallus gallus) [TaxId:9031] [311385] (74 PDB entries)
  8. 2541723Domain d4i4tf2: 4i4t F:77-378 [298255]
    Other proteins in same PDB: d4i4ta1, d4i4ta2, d4i4tb1, d4i4tb2, d4i4tc1, d4i4tc2, d4i4td1, d4i4td2, d4i4te_, d4i4tf1, d4i4tf3
    automated match to d3tiia2
    complexed with acp, ca, cl, gdp, gol, gtp, mes, mg, tyr, zpn

Details for d4i4tf2

PDB Entry: 4i4t (more details), 1.8 Å

PDB Description: crystal structure of tubulin-rb3-ttl-zampanolide complex
PDB Compounds: (F:) Tubulin Tyrosine ligase, TTL

SCOPe Domain Sequences for d4i4tf2:

Sequence, based on SEQRES records: (download)

>d4i4tf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d4i4tf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnltderevflaaynrrregregnvwiakssaga
kgegilisseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniyl
yregvlrtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdal
nttlensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievnga
pacaqklyaelcqgivdvaissvfplaptsifikl

SCOPe Domain Coordinates for d4i4tf2:

Click to download the PDB-style file with coordinates for d4i4tf2.
(The format of our PDB-style files is described here.)

Timeline for d4i4tf2: