Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein Sulfolipid biosynthesis protein SQD1 [51763] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [51764] (4 PDB entries) |
Domain d1qrra_: 1qrr A: [29824] complexed with nad, so4, upg |
PDB Entry: 1qrr (more details), 1.6 Å
SCOPe Domain Sequences for d1qrra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qrra_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} krvmviggdgycgwatalhlskknyevcivdnlvrrlfdhqlglesltpiasihdrisrw kaltgksielyvgdicdfeflaesfksfepdsvvhfgeqrsapysmidrsravytqhnnv igtlnvlfaikefgeechlvklgtmgeygtpnidieegyitithngrtdtlpypkqassf yhlskvhdshniaftckawgiratdlnqgvvygvktdetemheelrnrldydavfgtaln rfcvqaavghpltvygkggqtrgyldirdtvqcveiaianpakagefrvfnqfteqfsvn elaslvtkagsklgldvkkmtvpnprveaeehyynakhtklmelglephylsdslldsll nfavqfkdrvdtkqimpsvswkkigvktks
Timeline for d1qrra_: