Lineage for d1qrra_ (1qrr A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 687114Protein Sulfolipid biosynthesis protein SQD1 [51763] (1 species)
  7. 687115Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [51764] (4 PDB entries)
  8. 687117Domain d1qrra_: 1qrr A: [29824]

Details for d1qrra_

PDB Entry: 1qrr (more details), 1.6 Å

PDB Description: crystal structure of sqd1 protein complex with nad and udp-glucose
PDB Compounds: (A:) sulfolipid biosynthesis (SQD1) PROTEIN

SCOP Domain Sequences for d1qrra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrra_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
krvmviggdgycgwatalhlskknyevcivdnlvrrlfdhqlglesltpiasihdrisrw
kaltgksielyvgdicdfeflaesfksfepdsvvhfgeqrsapysmidrsravytqhnnv
igtlnvlfaikefgeechlvklgtmgeygtpnidieegyitithngrtdtlpypkqassf
yhlskvhdshniaftckawgiratdlnqgvvygvktdetemheelrnrldydavfgtaln
rfcvqaavghpltvygkggqtrgyldirdtvqcveiaianpakagefrvfnqfteqfsvn
elaslvtkagsklgldvkkmtvpnprveaeehyynakhtklmelglephylsdslldsll
nfavqfkdrvdtkqimpsvswkkigvktks

SCOP Domain Coordinates for d1qrra_:

Click to download the PDB-style file with coordinates for d1qrra_.
(The format of our PDB-style files is described here.)

Timeline for d1qrra_: