Lineage for d1eq2i_ (1eq2 I:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2449959Protein ADP-L-glycero-D-mannoheptose 6-epimerase [51761] (1 species)
  7. 2449960Species Escherichia coli [TaxId:562] [51762] (1 PDB entry)
  8. 2449969Domain d1eq2i_: 1eq2 I: [29822]
    complexed with adq, nap

Details for d1eq2i_

PDB Entry: 1eq2 (more details), 2 Å

PDB Description: the crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase
PDB Compounds: (I:) ADP-l-glycero-d-mannoheptose 6-epimerase

SCOPe Domain Sequences for d1eq2i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eq2i_ c.2.1.2 (I:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]}
miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
ggrtsdfiesreyekplnvygyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
eymawln

SCOPe Domain Coordinates for d1eq2i_:

Click to download the PDB-style file with coordinates for d1eq2i_.
(The format of our PDB-style files is described here.)

Timeline for d1eq2i_: