Lineage for d1eq2i_ (1eq2 I:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 protein domains)
  6. 20129Protein ADP-L-glycero-D-mannoheptose 6-epimerase [51761] (1 species)
  7. 20130Species Escherichia coli [TaxId:562] [51762] (1 PDB entry)
  8. 20139Domain d1eq2i_: 1eq2 I: [29822]

Details for d1eq2i_

PDB Entry: 1eq2 (more details), 2 Å

PDB Description: the crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase

SCOP Domain Sequences for d1eq2i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eq2i_ c.2.1.2 (I:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli}
miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
ggrtsdfiesreyekplnvygyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
eymawln

SCOP Domain Coordinates for d1eq2i_:

Click to download the PDB-style file with coordinates for d1eq2i_.
(The format of our PDB-style files is described here.)

Timeline for d1eq2i_: