Lineage for d1eq2a_ (1eq2 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 819873Protein ADP-L-glycero-D-mannoheptose 6-epimerase [51761] (1 species)
  7. 819874Species Escherichia coli [TaxId:562] [51762] (1 PDB entry)
  8. 819875Domain d1eq2a_: 1eq2 A: [29814]

Details for d1eq2a_

PDB Entry: 1eq2 (more details), 2 Å

PDB Description: the crystal structure of adp-l-glycero-d-mannoheptose 6-epimerase
PDB Compounds: (A:) ADP-l-glycero-d-mannoheptose 6-epimerase

SCOP Domain Sequences for d1eq2a_:

Sequence, based on SEQRES records: (download)

>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]}
miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
ggrtsdfiesreyekplnvygyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
masvafhlntqlnngespklfegsenfkrdfvyvgdvadvnlwflengvsgifnlgtgra
esfqavadatlayhkkgqieyipfpdklkgryqaftqadltnlraagydkpfktvaegvt
eymawln

Sequence, based on observed residues (ATOM records): (download)

>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]}
miivtggagfigsnivkalndkgitdilvvdnlkdgtkfvnlvdlniadymdkedfliqi
mageefgdveaifhegacssttewdgkymmdnnyqyskellhyclereipflyassaaty
ggrtsdfiesreyekplnvygyskflfdeyvrqilpeansqivgfryfnvygpreghkgs
masvafhlntqlnnkrdfvyvgdvadvnlwflengvsgifnlgtgraesfqavadatyqa
ftqadltnlraagydkpfktvaegvteymawln

SCOP Domain Coordinates for d1eq2a_:

Click to download the PDB-style file with coordinates for d1eq2a_.
(The format of our PDB-style files is described here.)

Timeline for d1eq2a_: