SCOP 1.71: Domain d1bwsa_: 1bws A:

Lineage for d1bwsa_ (1bws A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (53 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) [51757] (1 species)

7. Species Escherichia coli [TaxId:562] [51758] (8 PDB entries)

8. Domain d1bwsa_: 1bws A: [29812]
   complexed with ndp

Details for d1bwsa_

PDB Entry: 1bws, 2.2 Å

PDB Description: crystal structure of gdp-4-keto-6-deoxy-d-mannose epimerase/reductase from escherichia coli a key enzyme in the biosynthesis of gdp-l-fucose

SCOP Domain Sequences for d1bwsa_:

Sequence; same for both SEQRES and ATOM records:

>d1bwsa_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli}
kqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvyla
aakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpmaes
ellqgtleptnepyaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshvip
allrrfheataqnapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpmlsh
invgtgvdctirdlaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheisle
aglastyqwflenq

Timeline for d1bwsa_:

• d1bwsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1bwsa_ appears in SCOP 1.69
  
• d1bwsa_ appears in SCOP 1.73
  
• d1bwsa_ appears in the current release, SCOPe 2.08