Lineage for d1bsva_ (1bsv A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins)
  6. 20228Protein GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) [51757] (1 species)
  7. 20229Species Escherichia coli [TaxId:562] [51758] (8 PDB entries)
  8. 20234Domain d1bsva_: 1bsv A: [29809]

Details for d1bsva_

PDB Entry: 1bsv (more details), 2.2 Å

PDB Description: gdp-fucose synthetase from escherichia coli complex with nadph

SCOP Domain Sequences for d1bsva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsva_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli}
kqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvyla
aakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpmaes
ellqgtleptnepyaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshvip
allrrfheataqnapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpmlsh
invgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheisle
aglastyqwflenqdrf

SCOP Domain Coordinates for d1bsva_:

Click to download the PDB-style file with coordinates for d1bsva_.
(The format of our PDB-style files is described here.)

Timeline for d1bsva_: