Lineage for d1e7qa_ (1e7q A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 protein domains)
  6. 20228Protein GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) [51757] (1 species)
  7. 20229Species Escherichia coli [TaxId:562] [51758] (8 PDB entries)
  8. 20232Domain d1e7qa_: 1e7q A: [29807]

Details for d1e7qa_

PDB Entry: 1e7q (more details), 1.6 Å

PDB Description: gdp 4-keto-6-deoxy-d-mannose epimerase reductase s107a

SCOP Domain Sequences for d1e7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7qa_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli}
kqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvyla
aakvggivanntypadfiyqnmmiesniihaahqndvnkllflgasciypklakqpmaes
ellqgtleptnepyaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshvip
allrrfheataqsapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpmlsh
invgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheisle
aglastyqwflenq

SCOP Domain Coordinates for d1e7qa_:

Click to download the PDB-style file with coordinates for d1e7qa_.
(The format of our PDB-style files is described here.)

Timeline for d1e7qa_: