Lineage for d1e7sa_ (1e7s A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826923Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1827741Protein GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) [51757] (1 species)
  7. 1827742Species Escherichia coli [TaxId:562] [51758] (8 PDB entries)
  8. 1827744Domain d1e7sa_: 1e7s A: [29806]
    complexed with nap, so4, trs, uvw

Details for d1e7sa_

PDB Entry: 1e7s (more details), 1.5 Å

PDB Description: gdp 4-keto-6-deoxy-d-mannose epimerase reductase k140r
PDB Compounds: (A:) GDP-fucose synthetase

SCOPe Domain Sequences for d1e7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e7sa_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]}
kqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvyla
aakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpmaes
ellqgtleptnepyaiariagiklcesynrqygrdyrsvmptnlygphdnfhpsnshvip
allrrfheataqsapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpmlsh
invgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheisle
aglastyqwflenq

SCOPe Domain Coordinates for d1e7sa_:

Click to download the PDB-style file with coordinates for d1e7sa_.
(The format of our PDB-style files is described here.)

Timeline for d1e7sa_: