| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
| Protein GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) [51757] (1 species) |
| Species Escherichia coli [TaxId:562] [51758] (8 PDB entries) |
| Domain d1e6ua_: 1e6u A: [29805] complexed with nap, so4, trs, uvw has additional subdomain(s) that are not in the common domain |
PDB Entry: 1e6u (more details), 1.45 Å
SCOPe Domain Sequences for d1e6ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]}
akqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvyl
aaakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpmae
sellqgtleptnepyaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshvi
pallrrfheataqkapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpmls
hinvgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheisl
eaglastyqwflenq
Timeline for d1e6ua_: