Lineage for d1bxkb_ (1bxk B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091079Protein dTDP-glucose 4,6-dehydratase (RmlB) [51755] (4 species)
  7. 2091080Species Escherichia coli [TaxId:562] [51756] (1 PDB entry)
  8. 2091082Domain d1bxkb_: 1bxk B: [29804]
    complexed with nad

Details for d1bxkb_

PDB Entry: 1bxk (more details), 1.9 Å

PDB Description: dtdp-glucose 4,6-dehydratase from e. coli
PDB Compounds: (B:) protein (dtdp-glucose 4,6-dehydratase)

SCOPe Domain Sequences for d1bxkb_:

Sequence, based on SEQRES records: (download)

>d1bxkb_ c.2.1.2 (B:) dTDP-glucose 4,6-dehydratase (RmlB) {Escherichia coli [TaxId: 562]}
mrkilitggagfigsalvryiinetsdavvvvdkltyagnlmslapvaqserfafekvdi
cdraelarvftehqpdcvmhlaaeshvdrsidgpaafietnivgtytlleaaraywnalt
edkksafrfhhistdevygdlhstddfftettpyapsspysaskassdhlvrawlrtygl
ptlitncsnnygpyhfpekliplmilnalagkslpvygngqqirdwlyvedharalycva
ttgkvgetynigghnerknldvveticelleelapnkphgvahyrdlitfvadrpghdlr
yaidaskiarelgcvpqetfesgmrktvqwylaneswwkqvqdgsyqger

Sequence, based on observed residues (ATOM records): (download)

>d1bxkb_ c.2.1.2 (B:) dTDP-glucose 4,6-dehydratase (RmlB) {Escherichia coli [TaxId: 562]}
mrkilitggagfigsalvryiinetsdavvvvdkltyagnlmslapvaqserfafekvdi
cdraelarvftehqpdcvmhlaaeshvdrsidgpaafietnivgtytlleaaraywnalt
edkksafrfhhistdevygdlhstddfftettpyapsspysaskassdhlvrawlrtygl
ptlitncsnnygpyhfpekliplmilnalagkslpvygngqqirdwlyvedharalycva
ttgkvgetynigghnerknldvveticelleelapnkphgvahyrdlitfvalryaidas
kiarelgcvpqetfesgmrktvqwylaneswwkqvqdgsyqger

SCOPe Domain Coordinates for d1bxkb_:

Click to download the PDB-style file with coordinates for d1bxkb_.
(The format of our PDB-style files is described here.)

Timeline for d1bxkb_: