Lineage for d1bxka_ (1bxk A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66266Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (26 proteins)
  6. 66386Protein dTDP-glucose 4,6-dehydratase (RmlB) [51755] (2 species)
  7. 66387Species Escherichia coli [TaxId:562] [51756] (1 PDB entry)
  8. 66388Domain d1bxka_: 1bxk A: [29803]

Details for d1bxka_

PDB Entry: 1bxk (more details), 1.9 Å

PDB Description: dtdp-glucose 4,6-dehydratase from e. coli

SCOP Domain Sequences for d1bxka_:

Sequence, based on SEQRES records: (download)

>d1bxka_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Escherichia coli}
mrkilitggagfigsalvryiinetsdavvvvdkltyagnlmslapvaqserfafekvdi
cdraelarvftehqpdcvmhlaaeshvdrsidgpaafietnivgtytlleaaraywnalt
edkksafrfhhistdevygdlhstddfftettpyapsspysaskassdhlvrawlrtygl
ptlitncsnnygpyhfpekliplmilnalagkslpvygngqqirdwlyvedharalycva
ttgkvgetynigghnerknldvveticelleelapnkphgvahyrdlitfvadrpghdlr
yaidaskiarelgcvpqetfesgmrktvqwylaneswwkqvqdgsyqgerlglkg

Sequence, based on observed residues (ATOM records): (download)

>d1bxka_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Escherichia coli}
mrkilitggagfigsalvryiinetsdavvvvdkltyagnlmslapvaqserfafekvdi
cdraelarvftehqpdcvmhlaaeshvdrsidgpaafietnivgtytlleaaraywnalt
edkksafrfhhistdevygdlhstddfftettpyapsspysaskassdhlvrawlrtygl
ptlitncsnnygpyhfpekliplmilnalagkslpvygngqqirdwlyvedharalycva
ttgkvgetynigghnerknldvveticelleelapnkphgvahyrdlitfryaidaskia
relgcvpqetfesgmrktvqwylaneswwkqvqdgsyqgeg

SCOP Domain Coordinates for d1bxka_:

Click to download the PDB-style file with coordinates for d1bxka_.
(The format of our PDB-style files is described here.)

Timeline for d1bxka_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bxkb_