Lineage for d1kvq__ (1kvq -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins) 
Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (2 species) 
Species Escherichia coli [TaxId:562] [51753] (14 PDB entries) 
Domain d1kvq__: 1kvq - [29797]
Details for d1kvq__
PDB Entry: 1kvq (more details), 2.15 Å
PDB Description: udp-galactose 4-epimerase complexed with udp-phenol
SCOP Domain Sequences for d1kvq__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kvq__ c.2.1.2 (-) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli}
mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
fssaatvygdnpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
dghvvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd
SCOP Domain Coordinates for d1kvq__:
Click to download the PDB-style file with coordinates for d1kvq__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kvq__:
- d1kvq__ appears in SCOP 1.57
- d1kvq__ appears in the current release, SCOPe 2.08, called d1kvqa_
View in 3D