Lineage for d1kvu__ (1kvu -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins) 
Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (2 species) 
Species Escherichia coli [TaxId:562] [51753] (14 PDB entries) 
Domain d1kvu__: 1kvu - [29794]
Details for d1kvu__
PDB Entry: 1kvu (more details), 1.9 Å
PDB Description: udp-galactose 4-epimerase complexed with udp-phenol
SCOP Domain Sequences for d1kvu__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kvu__ c.2.1.2 (-) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli}
mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
fsssatvygdqpkipyvesfptgtpqspfgksklmveqiltdlqkaqpdwsiallryfnp
vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
dghvvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd
SCOP Domain Coordinates for d1kvu__:
Click to download the PDB-style file with coordinates for d1kvu__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kvu__:
- d1kvu__ appears in SCOP 1.57
- d1kvu__ appears in the current release, SCOPe 2.08, called d1kvua_
View in 3D