Lineage for d2udpb_ (2udp B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 proteins) 
Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (2 species) 
Species Escherichia coli [TaxId:562] [51753] (14 PDB entries) 
Domain d2udpb_: 2udp B: [29792]
Details for d2udpb_
PDB Entry: 2udp (more details), 1.8 Å
PDB Description: udp-galactose 4-epimerase complexed with udp-phenol
SCOP Domain Sequences for d2udpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2udpb_ c.2.1.2 (B:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli}
mrvlvtggsgyigshtcvqllqnghdviildnlcnskrsvlpvierlggkhptfvegdir
nealmteilhdhaidtvihfaglkavgesvqkpleyydnnvngtlrlisamraanvknfi
fsssatvygdqpkipyvesfptgtpqspygksklmveqiltdlqkaqpdwsiallryfnp
vgahpsgdmgedpqgipnnlmpyiaqvavgrrdslaifgndyptedgtgvrdyihvmdla
dghvvameklankpgvhiynlgagvgnsvldvvnafskacgkpvnyhfaprregdlpayw
adaskadrelnwrvtrtldemaqdtwhwqsrhpqgypd
SCOP Domain Coordinates for d2udpb_:
Click to download the PDB-style file with coordinates for d2udpb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2udpb_:
- d2udpb_ appears in SCOP 1.57
- d2udpb_ appears in the current release, SCOPe 2.08
View in 3D
