Lineage for d1qorb2 (1qor B:113-291)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819420Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 819726Protein Quinone oxidoreductase [51747] (3 species)
  7. 819727Species Escherichia coli [TaxId:562] [51748] (1 PDB entry)
  8. 819729Domain d1qorb2: 1qor B:113-291 [29783]
    Other proteins in same PDB: d1qora1, d1qorb1
    complexed with nap, so4

Details for d1qorb2

PDB Entry: 1qor (more details), 2.2 Å

PDB Description: crystal structure of escherichia coli quinone oxidoreductase complexed with nadph
PDB Compounds: (B:) quinone oxidoreductase

SCOP Domain Sequences for d1qorb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qorb2 c.2.1.1 (B:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]}
isfeqaaasflkgltvyyllrktyeikpdeqflfhaaaggvgliacqwakalgakligtv
gtaqkaqsalkagawqvinyreedlverlkeitggkkvrvvydsvgrdtwersldclqrr
glmvsfgnssgavtgvnlgilnqkgslyvtrpslqgyittreelteasnelfsliasgv

SCOP Domain Coordinates for d1qorb2:

Click to download the PDB-style file with coordinates for d1qorb2.
(The format of our PDB-style files is described here.)

Timeline for d1qorb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qorb1