Lineage for d1e3ja2 (1e3j A:143-312)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102559Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 2102857Protein Ketose reductase (sorbitol dehydrogenase) [51745] (2 species)
  7. 2102871Species Silverleaf whitefly (Bemisia argentifolii) [TaxId:77855] [51746] (1 PDB entry)
  8. 2102872Domain d1e3ja2: 1e3j A:143-312 [29781]
    Other proteins in same PDB: d1e3ja1
    CASP4
    complexed with bo3, po4, zn

Details for d1e3ja2

PDB Entry: 1e3j (more details), 2.3 Å

PDB Description: ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly
PDB Compounds: (A:) nadp(h)-dependent ketose reductase

SCOPe Domain Sequences for d1e3ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]}
vsleegalleplsvgvhacrragvqlgttvlvigagpiglvsvlaakaygafvvctarsp
rrlevakncgadvtlvvdpakeeessiierirsaigdlpnvtidcsgnekcitiginitr
tggtlmlvgmgsqmvtvplvnacareidiksvfrycndypialemvasgr

SCOPe Domain Coordinates for d1e3ja2:

Click to download the PDB-style file with coordinates for d1e3ja2.
(The format of our PDB-style files is described here.)

Timeline for d1e3ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3ja1