Lineage for d1e3ja2 (1e3j A:151-313)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66137Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 66259Protein Ketose reductase (sorbitol dehydrogenase) [51745] (1 species)
  7. 66260Species Silverleaf whitefly (Bemisia argentifolii) [TaxId:77855] [51746] (1 PDB entry)
  8. 66261Domain d1e3ja2: 1e3j A:151-313 [29781]
    Other proteins in same PDB: d1e3ja1

Details for d1e3ja2

PDB Entry: 1e3j (more details), 2.3 Å

PDB Description: ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly

SCOP Domain Sequences for d1e3ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ja2 c.2.1.1 (A:151-313) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii)}
leplsvgvhacrragvqlgttvlvigagpiglvsvlaakaygafvvctarsprrlevakn
cgadvtlvvdpakeeessiierirsaigdlpnvtidcsgnekcitiginitrtggtlmlv
gmgsqmvtvplvnacareidiksvfrycndypialemvasgrc

SCOP Domain Coordinates for d1e3ja2:

Click to download the PDB-style file with coordinates for d1e3ja2.
(The format of our PDB-style files is described here.)

Timeline for d1e3ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3ja1