Lineage for d1ykfc2 (1ykf C:140-313)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841248Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 2841266Species Thermoanaerobacter brockii [TaxId:29323] [51744] (3 PDB entries)
  8. 2841269Domain d1ykfc2: 1ykf C:140-313 [29775]
    Other proteins in same PDB: d1ykfa1, d1ykfb1, d1ykfc1, d1ykfd1
    complexed with nap, zn

Details for d1ykfc2

PDB Entry: 1ykf (more details), 2.5 Å

PDB Description: nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii
PDB Compounds: (C:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1ykfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykfc2 c.2.1.1 (C:140-313) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
ipleaavmipdmmttgfhgaeladielgatvavlgigpvglmavagaklrgagriiavgs
rpvcvdaakyygatdivnykdgpiesqimnltegkgvdaaiiaggnadimatavkivkpg
gtianvnyfgegevlpvprlewgcgmahktikgglcpggrlrmerlidlvfykr

SCOPe Domain Coordinates for d1ykfc2:

Click to download the PDB-style file with coordinates for d1ykfc2.
(The format of our PDB-style files is described here.)

Timeline for d1ykfc2: