Lineage for d1ykfb2 (1ykf B:151-314)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175019Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 175125Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 175135Species Thermoanaerobacter brockii [TaxId:29323] [51744] (2 PDB entries)
  8. 175137Domain d1ykfb2: 1ykf B:151-314 [29774]
    Other proteins in same PDB: d1ykfa1, d1ykfb1, d1ykfc1, d1ykfd1

Details for d1ykfb2

PDB Entry: 1ykf (more details), 2.5 Å

PDB Description: nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii

SCOP Domain Sequences for d1ykfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykfb2 c.2.1.1 (B:151-314) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii}
mmttgfhgaeladielgatvavlgigpvglmavagaklrgagriiavgsrpvcvdaakyy
gatdivnykdgpiesqimnltegkgvdaaiiaggnadimatavkivkpggtianvnyfge
gevlpvprlewgcgmahktikgglcpggrlrmerlidlvfykrv

SCOP Domain Coordinates for d1ykfb2:

Click to download the PDB-style file with coordinates for d1ykfb2.
(The format of our PDB-style files is described here.)

Timeline for d1ykfb2: