Lineage for d1ykfa2 (1ykf A:151-314)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 117974Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 118074Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 118084Species Thermoanaerobacter brockii [TaxId:29323] [51744] (2 PDB entries)
  8. 118085Domain d1ykfa2: 1ykf A:151-314 [29773]
    Other proteins in same PDB: d1ykfa1, d1ykfb1, d1ykfc1, d1ykfd1

Details for d1ykfa2

PDB Entry: 1ykf (more details), 2.5 Å

PDB Description: nadp-dependent alcohol dehydrogenase from thermoanaerobium brockii

SCOP Domain Sequences for d1ykfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ykfa2 c.2.1.1 (A:151-314) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii}
mmttgfhgaeladielgatvavlgigpvglmavagaklrgagriiavgsrpvcvdaakyy
gatdivnykdgpiesqimnltegkgvdaaiiaggnadimatavkivkpggtianvnyfge
gevlpvprlewgcgmahktikgglcpggrlrmerlidlvfykrv

SCOP Domain Coordinates for d1ykfa2:

Click to download the PDB-style file with coordinates for d1ykfa2.
(The format of our PDB-style files is described here.)

Timeline for d1ykfa2: