Lineage for d1pedd2 (1ped D:151-314)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66137Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 66237Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 66238Species Clostridium beijerinckii [51743] (2 PDB entries)
  8. 66246Domain d1pedd2: 1ped D:151-314 [29772]
    Other proteins in same PDB: d1peda1, d1pedb1, d1pedc1, d1pedd1

Details for d1pedd2

PDB Entry: 1ped (more details), 2.15 Å

PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)

SCOP Domain Sequences for d1pedd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pedd2 c.2.1.1 (D:151-314) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgsrpicveaakfy
gatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpggiisninyhgs
gdalliprvewgcgmahktikgglcpggrlraemlrdmvvynrv

SCOP Domain Coordinates for d1pedd2:

Click to download the PDB-style file with coordinates for d1pedd2.
(The format of our PDB-style files is described here.)

Timeline for d1pedd2: