Lineage for d1pedd2 (1ped D:140-313)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841248Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 2841249Species Clostridium beijerinckii [TaxId:1520] [51743] (4 PDB entries)
  8. 2841265Domain d1pedd2: 1ped D:140-313 [29772]
    Other proteins in same PDB: d1peda1, d1pedb1, d1pedc1, d1pedd1
    complexed with zn

Details for d1pedd2

PDB Entry: 1ped (more details), 2.15 Å

PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)
PDB Compounds: (D:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1pedd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pedd2 c.2.1.1 (D:140-313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mplenavmitdmmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgs
rpicveaakfygatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpg
giisninyhgsgdalliprvewgcgmahktikgglcpggrlraemlrdmvvynr

SCOPe Domain Coordinates for d1pedd2:

Click to download the PDB-style file with coordinates for d1pedd2.
(The format of our PDB-style files is described here.)

Timeline for d1pedd2: