Lineage for d1pedb2 (1ped B:140-313)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 574153Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 574344Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 574345Species Clostridium beijerinckii [51743] (3 PDB entries)
  8. 574351Domain d1pedb2: 1ped B:140-313 [29770]
    Other proteins in same PDB: d1peda1, d1pedb1, d1pedc1, d1pedd1

Details for d1pedb2

PDB Entry: 1ped (more details), 2.15 Å

PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)

SCOP Domain Sequences for d1pedb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pedb2 c.2.1.1 (B:140-313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mplenavmitdmmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgs
rpicveaakfygatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpg
giisninyhgsgdalliprvewgcgmahktikgglcpggrlraemlrdmvvynr

SCOP Domain Coordinates for d1pedb2:

Click to download the PDB-style file with coordinates for d1pedb2.
(The format of our PDB-style files is described here.)

Timeline for d1pedb2: