Lineage for d1pedb2 (1ped B:151-314)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175019Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 175125Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 175126Species Clostridium beijerinckii [51743] (2 PDB entries)
  8. 175132Domain d1pedb2: 1ped B:151-314 [29770]
    Other proteins in same PDB: d1peda1, d1pedb1, d1pedc1, d1pedd1

Details for d1pedb2

PDB Entry: 1ped (more details), 2.15 Å

PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)

SCOP Domain Sequences for d1pedb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pedb2 c.2.1.1 (B:151-314) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgsrpicveaakfy
gatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpggiisninyhgs
gdalliprvewgcgmahktikgglcpggrlraemlrdmvvynrv

SCOP Domain Coordinates for d1pedb2:

Click to download the PDB-style file with coordinates for d1pedb2.
(The format of our PDB-style files is described here.)

Timeline for d1pedb2: