Lineage for d1kevd2 (1kev D:151-314)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175019Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 175125Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 175126Species Clostridium beijerinckii [51743] (2 PDB entries)
  8. 175130Domain d1kevd2: 1kev D:151-314 [29768]
    Other proteins in same PDB: d1keva1, d1kevb1, d1kevc1, d1kevd1

Details for d1kevd2

PDB Entry: 1kev (more details), 2.05 Å

PDB Description: structure of nadp-dependent alcohol dehydrogenase

SCOP Domain Sequences for d1kevd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kevd2 c.2.1.1 (D:151-314) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgsrpicveaakfy
gatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpggiisninyhgs
gdalliprvewgcgmahktikgglcpggrlraemlrdmvvynrv

SCOP Domain Coordinates for d1kevd2:

Click to download the PDB-style file with coordinates for d1kevd2.
(The format of our PDB-style files is described here.)

Timeline for d1kevd2: