Lineage for d1keva2 (1kev A:140-313)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 685977Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 686176Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 686177Species Clostridium beijerinckii [TaxId:1520] [51743] (3 PDB entries)
  8. 686186Domain d1keva2: 1kev A:140-313 [29765]
    Other proteins in same PDB: d1keva1, d1kevb1, d1kevc1, d1kevd1

Details for d1keva2

PDB Entry: 1kev (more details), 2.05 Å

PDB Description: structure of nadp-dependent alcohol dehydrogenase
PDB Compounds: (A:) NADP-dependent alcohol dehydrogenase

SCOP Domain Sequences for d1keva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keva2 c.2.1.1 (A:140-313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mplenavmitdmmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgs
rpicveaakfygatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpg
giisninyhgsgdalliprvewgcgmahktikgglcpggrlraemlrdmvvynr

SCOP Domain Coordinates for d1keva2:

Click to download the PDB-style file with coordinates for d1keva2.
(The format of our PDB-style files is described here.)

Timeline for d1keva2: