Lineage for d1keva2 (1kev A:151-314)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 117974Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 118074Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 118075Species Clostridium beijerinckii [51743] (2 PDB entries)
  8. 118076Domain d1keva2: 1kev A:151-314 [29765]
    Other proteins in same PDB: d1keva1, d1kevb1, d1kevc1, d1kevd1

Details for d1keva2

PDB Entry: 1kev (more details), 2.05 Å

PDB Description: structure of nadp-dependent alcohol dehydrogenase

SCOP Domain Sequences for d1keva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1keva2 c.2.1.1 (A:151-314) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgsrpicveaakfy
gatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpggiisninyhgs
gdalliprvewgcgmahktikgglcpggrlraemlrdmvvynrv

SCOP Domain Coordinates for d1keva2:

Click to download the PDB-style file with coordinates for d1keva2.
(The format of our PDB-style files is described here.)

Timeline for d1keva2: