Lineage for d1cdob2 (1cdo B:165-339)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449373Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 2449394Protein Alcohol dehydrogenase [51737] (9 species)
  7. 2449403Species Cod (Gadus callarias) [TaxId:8053] [51741] (1 PDB entry)
  8. 2449405Domain d1cdob2: 1cdo B:165-339 [29764]
    Other proteins in same PDB: d1cdoa1, d1cdob1
    complexed with nad, zn

Details for d1cdob2

PDB Entry: 1cdo (more details), 2.05 Å

PDB Description: alcohol dehydrogenase (e.c.1.1.1.1) (ee isozyme) complexed with nicotinamide adenine dinucleotide (nad), and zinc
PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d1cdob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdob2 c.2.1.1 (B:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]}
apldtvcllgcgvstgfgaavntakvepgstcavfglgavglaavmgchsagakriiavd
lnpdkfekakvfgatdfvnpndhsepisqvlskmtnggvdfslecvgnvgvmrnalescl
kgwgvsvlvgwtdlhdvatrpiqliagrtwkgsmfggfkgkdgvpkmvkayldkk

SCOPe Domain Coordinates for d1cdob2:

Click to download the PDB-style file with coordinates for d1cdob2.
(The format of our PDB-style files is described here.)

Timeline for d1cdob2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdob1