Lineage for d1cdoa2 (1cdo A:176-324)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 19979Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 19980Protein Alcohol dehydrogenase [51737] (4 species)
  7. 19981Species Cod (Gadus callarias) [TaxId:8053] [51741] (1 PDB entry)
  8. 19982Domain d1cdoa2: 1cdo A:176-324 [29763]
    Other proteins in same PDB: d1cdoa1, d1cdob1

Details for d1cdoa2

PDB Entry: 1cdo (more details), 2.05 Å

PDB Description: alcohol dehydrogenase (e.c.1.1.1.1) (ee isozyme) complexed with nicotinamide adenine dinucleotide (nad), and zinc
PDB Compounds: (A:)

SCOP Domain Sequences for d1cdoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdoa2 c.2.1.1 (A:176-324) Alcohol dehydrogenase {Cod (Gadus callarias)}
gvstgfgaavntakvepgstcavfglgavglaavmgchsagakriiavdlnpdkfekakv
fgatdfvnpndhsepisqvlskmtnggvdfslecvgnvgvmrnalesclkgwgvsvlvgw
tdlhdvatrpiqliagrtwkgsmfggfkg

SCOP Domain Coordinates for d1cdoa2:

Click to download the PDB-style file with coordinates for d1cdoa2.
(The format of our PDB-style files is described here.)

Timeline for d1cdoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cdoa1