Lineage for d1e3lb2 (1e3l B:168-341)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1826590Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 1826611Protein Alcohol dehydrogenase [51737] (9 species)
  7. 1826771Species Mouse (Mus musculus), class II [TaxId:10090] [51740] (3 PDB entries)
  8. 1826775Domain d1e3lb2: 1e3l B:168-341 [29762]
    Other proteins in same PDB: d1e3la1, d1e3lb1
    complexed with nad, zn; mutant

Details for d1e3lb2

PDB Entry: 1e3l (more details), 2.5 Å

PDB Description: p47h mutant of mouse class ii alcohol dehydrogenase complex with nadh
PDB Compounds: (B:) alcohol dehydrogenase, class II

SCOPe Domain Sequences for d1e3lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3lb2 c.2.1.1 (B:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]}
anlervcligcgfssgygaaintakvtpgstcavfglgcvglsaiigckiagasriiaid
ingekfpkakalgatdclnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctv
lgwgsctvvgakvdemtiptvdvilgrsingtffggwksvdsvpnlvsdyknkk

SCOPe Domain Coordinates for d1e3lb2:

Click to download the PDB-style file with coordinates for d1e3lb2.
(The format of our PDB-style files is described here.)

Timeline for d1e3lb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3lb1