SCOP 1.65: Domain d1e3eb2: 1e3e B:168-341

Lineage for d1e3eb2 (1e3e B:168-341)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (8 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (6 species)

7. Species Mouse (Mus musculus), class II [TaxId:10090] [51740] (3 PDB entries)

8. Domain d1e3eb2: 1e3e B:168-341 [29760]
   Other proteins in same PDB: d1e3ea1, d1e3eb1
   complexed with nad, zn

Details for d1e3eb2

PDB Entry: 1e3e, 2.12 Å

PDB Description: mouse class ii alcohol dehydrogenase complex with nadh

SCOP Domain Sequences for d1e3eb2:

Sequence; same for both SEQRES and ATOM records:

>d1e3eb2 c.2.1.1 (B:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II}
anlervcligcgfssgygaaintakvtpgstcavfglgcvglsaiigckiagasriiaid
ingekfpkakalgatdclnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctv
lgwgsctvvgakvdemtiptvdvilgrsingtffggwksvdsvpnlvsdyknkk

Timeline for d1e3eb2:

• d1e3eb2 first appeared (with stable ids) in SCOP 1.55
  
• d1e3eb2 appears in SCOP 1.63
  
• d1e3eb2 appears in SCOP 1.67
  
• d1e3eb2 appears in the current release, SCOPe 2.08