Lineage for d1e3ib2 (1e3i B:175-324)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 19979Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 19980Protein Alcohol dehydrogenase [51737] (4 species)
  7. 20064Species Mouse (Mus musculus), class II [TaxId:10090] [51740] (3 PDB entries)
  8. 20066Domain d1e3ib2: 1e3i B:175-324 [29758]
    Other proteins in same PDB: d1e3ia1, d1e3ib1

Details for d1e3ib2

PDB Entry: 1e3i (more details), 2.08 Å

PDB Description: mouse class ii alcohol dehydrogenase complex with nadh and inhibitor

SCOP Domain Sequences for d1e3ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e3ib2 c.2.1.1 (B:175-324) Alcohol dehydrogenase {Mouse (Mus musculus), class II}
ligcgfssgygaaintakvtpgstcavfglgcvglsaiigckiagasriiaidingekfp
kakalgatdclnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctvlgwgsct
vvgakvdemtiptvdvilgrsingtffggw

SCOP Domain Coordinates for d1e3ib2:

Click to download the PDB-style file with coordinates for d1e3ib2.
(The format of our PDB-style files is described here.)

Timeline for d1e3ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e3ib1