![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
![]() | Protein Alcohol dehydrogenase [51737] (9 species) |
![]() | Species Mouse (Mus musculus), class II [TaxId:10090] [51740] (3 PDB entries) |
![]() | Domain d1e3ib2: 1e3i B:168-341 [29758] Other proteins in same PDB: d1e3ia1, d1e3ib1 complexed with cxf, nai, zn |
PDB Entry: 1e3i (more details), 2.08 Å
SCOPe Domain Sequences for d1e3ib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3ib2 c.2.1.1 (B:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} anlervcligcgfssgygaaintakvtpgstcavfglgcvglsaiigckiagasriiaid ingekfpkakalgatdclnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctv lgwgsctvvgakvdemtiptvdvilgrsingtffggwksvdsvpnlvsdyknkk
Timeline for d1e3ib2: