SCOPe 2.08: Domain d1e3ia2: 1e3i A:168-341

Lineage for d1e3ia2 (1e3i A:168-341)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Mouse (Mus musculus), class II [TaxId:10090] [51740] (3 PDB entries)

8. Domain d1e3ia2: 1e3i A:168-341 [29757]
   Other proteins in same PDB: d1e3ia1, d1e3ib1
   complexed with cxf, nai, zn

Details for d1e3ia2

PDB Entry: 1e3i, 2.08 Å

PDB Description: mouse class ii alcohol dehydrogenase complex with nadh and inhibitor

PDB Compounds: (A:) alcohol dehydrogenase, class II

SCOPe Domain Sequences for d1e3ia2:

Sequence; same for both SEQRES and ATOM records:

>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]}
anlervcligcgfssgygaaintakvtpgstcavfglgcvglsaiigckiagasriiaid
ingekfpkakalgatdclnpreldkpvqdviteltaggvdysldcagtaqtlkaavdctv
lgwgsctvvgakvdemtiptvdvilgrsingtffggwksvdsvpnlvsdyknkk

Timeline for d1e3ia2:

• d1e3ia2 first appeared (with stable ids) in SCOP 1.55
  
• d1e3ia2 appears in SCOPe 2.07