![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
![]() | Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (6 proteins) N-terminal all-beta domain defines family |
![]() | Protein Alcohol dehydrogenase [51737] (5 species) |
![]() | Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (17 PDB entries) |
![]() | Domain d1agnc2: 1agn C:175-324 [29755] Other proteins in same PDB: d1agna1, d1agnb1, d1agnc1, d1agnd1 |
PDB Entry: 1agn (more details), 3 Å
SCOP Domain Sequences for d1agnc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agnc2 c.2.1.1 (C:175-324) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes} gfstgygaavktgkvkpgstcvvfglggvglsvimgcksagasriigidlnkdkfekama vgatecispkdstkpisevlsemtgnnvgytfevighletmidalaschmnygtsvvvgv ppsakmltydpmllftgrtwkgcvfgglks
Timeline for d1agnc2: