Lineage for d1agna2 (1agn A:163-338)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1346344Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 1346362Protein Alcohol dehydrogenase [51737] (9 species)
  7. 1346465Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 1346514Domain d1agna2: 1agn A:163-338 [29753]
    Other proteins in same PDB: d1agna1, d1agnb1, d1agnc1, d1agnd1
    sigma isozyme
    complexed with act, nad, zn

Details for d1agna2

PDB Entry: 1agn (more details), 3 Å

PDB Description: x-ray structure of human sigma alcohol dehydrogenase
PDB Compounds: (A:) human sigma alcohol dehydrogenase

SCOPe Domain Sequences for d1agna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agna2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
aappekvcligcgfstgygaavktgkvkpgstcvvfglggvglsvimgcksagasriigi
dlnkdkfekamavgatecispkdstkpisevlsemtgnnvgytfevighletmidalasc
hmnygtsvvvgvppsakmltydpmllftgrtwkgcvfgglksrddvpklvteflak

SCOPe Domain Coordinates for d1agna2:

Click to download the PDB-style file with coordinates for d1agna2.
(The format of our PDB-style files is described here.)

Timeline for d1agna2: