SCOP 1.71: Domain d3hudb2: 3hud B:163-338

Lineage for d3hudb2 (3hud B:163-338)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (22 PDB entries)

8. Domain d3hudb2: 3hud B:163-338 [29752]
   Other proteins in same PDB: d3huda1, d3hudb1
   complexed with nad, zn

Details for d3hudb2

PDB Entry: 3hud, 3.2 Å

PDB Description: the structure of human beta 1 beta 1 alcohol dehydrogenase: catalytic effects of non-active-site substitutions

SCOP Domain Sequences for d3hudb2:

Sequence; same for both SEQRES and ATOM records:

>d3hudb2 c.2.1.1 (B:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
asplekvcligcgfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiav
dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllcc
heacgtsvivgvppasqnlsinpmllltgrtwkgavyggfkskegipklvadfmak

Timeline for d3hudb2:

• d3hudb2 first appeared (with stable ids) in SCOP 1.55
  
• d3hudb2 appears in SCOP 1.69
  
• d3hudb2 appears in SCOP 1.73
  
• d3hudb2 appears in the current release, SCOPe 2.08