Lineage for d3hudb2 (3hud B:175-324)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66137Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 66138Protein Alcohol dehydrogenase [51737] (4 species)
  7. 66197Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (13 PDB entries)
  8. 66225Domain d3hudb2: 3hud B:175-324 [29752]
    Other proteins in same PDB: d3huda1, d3hudb1

Details for d3hudb2

PDB Entry: 3hud (more details), 3.2 Å

PDB Description: the structure of human beta 1 beta 1 alcohol dehydrogenase: catalytic effects of non-active-site substitutions

SCOP Domain Sequences for d3hudb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hudb2 c.2.1.1 (B:175-324) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakake
lgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgv
ppasqnlsinpmllltgrtwkgavyggfks

SCOP Domain Coordinates for d3hudb2:

Click to download the PDB-style file with coordinates for d3hudb2.
(The format of our PDB-style files is described here.)

Timeline for d3hudb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hudb1