Lineage for d3huda2 (3hud A:163-338)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819420Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
    N-terminal all-beta domain defines family
  6. 819438Protein Alcohol dehydrogenase [51737] (9 species)
  7. 819544Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)
    Uniprot P00326
    Uniprot P00325
    Uniprot P07327
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 819597Domain d3huda2: 3hud A:163-338 [29751]
    Other proteins in same PDB: d3huda1, d3hudb1

Details for d3huda2

PDB Entry: 3hud (more details), 3.2 Å

PDB Description: the structure of human beta 1 beta 1 alcohol dehydrogenase: catalytic effects of non-active-site substitutions
PDB Compounds: (A:) alcohol dehydrogenase

SCOP Domain Sequences for d3huda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3huda2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
asplekvcligcgfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiav
dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllcc
heacgtsvivgvppasqnlsinpmllltgrtwkgavyggfkskegipklvadfmak

SCOP Domain Coordinates for d3huda2:

Click to download the PDB-style file with coordinates for d3huda2.
(The format of our PDB-style files is described here.)

Timeline for d3huda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3huda1