Lineage for d1hdzb2 (1hdz B:163-338)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841006Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
    N-terminal all-beta domain defines family
  6. 2841027Protein Alcohol dehydrogenase [51737] (9 species)
  7. 2841162Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 2841212Domain d1hdzb2: 1hdz B:163-338 [29742]
    Other proteins in same PDB: d1hdza1, d1hdzb1
    complexed with cl, nad, zn

Details for d1hdzb2

PDB Entry: 1hdz (more details), 2.5 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences
PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d1hdzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdzb2 c.2.1.1 (B:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
asplekvcligcgfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiav
dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllcc
heacgtsvivgvppasqnlsinpmllltgrtwkgavyggfkskegipklvadfmak

SCOPe Domain Coordinates for d1hdzb2:

Click to download the PDB-style file with coordinates for d1hdzb2.
(The format of our PDB-style files is described here.)

Timeline for d1hdzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdzb1