Lineage for d1hdza2 (1hdz A:175-324)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 238225Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (6 proteins)
    N-terminal all-beta domain defines family
  6. 238226Protein Alcohol dehydrogenase [51737] (5 species)
  7. 238297Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (17 PDB entries)
  8. 238322Domain d1hdza2: 1hdz A:175-324 [29741]
    Other proteins in same PDB: d1hdza1, d1hdzb1

Details for d1hdza2

PDB Entry: 1hdz (more details), 2.45 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences

SCOP Domain Sequences for d1hdza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdza2 c.2.1.1 (A:175-324) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakake
lgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgv
ppasqnlsinpmllltgrtwkgavyggfks

SCOP Domain Coordinates for d1hdza2:

Click to download the PDB-style file with coordinates for d1hdza2.
(The format of our PDB-style files is described here.)

Timeline for d1hdza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdza1