SCOP 1.61: Domain d1hdza2: 1hdz A:175-324

Lineage for d1hdza2 (1hdz A:175-324)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)

5. Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)

6. Protein Alcohol dehydrogenase [51737] (4 species)

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (16 PDB entries)

8. Domain d1hdza2: 1hdz A:175-324 [29741]
   Other proteins in same PDB: d1hdza1, d1hdzb1

Details for d1hdza2

PDB Entry: 1hdz, 2.45 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences

SCOP Domain Sequences for d1hdza2:

Sequence; same for both SEQRES and ATOM records:

>d1hdza2 c.2.1.1 (A:175-324) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakake
lgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgv
ppasqnlsinpmllltgrtwkgavyggfks

Timeline for d1hdza2:

• d1hdza2 first appeared (with stable ids) in SCOP 1.55
  
• d1hdza2 appears in SCOP 1.59
  
• d1hdza2 appears in SCOP 1.63
  
• d1hdza2 appears in the current release, SCOPe 2.08