SCOP 1.65: Domain d1hdya2: 1hdy A:163-338

Lineage for d1hdya2 (1hdy A:163-338)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (8 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (6 species)

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (18 PDB entries)

8. Domain d1hdya2: 1hdy A:163-338 [29739]
   Other proteins in same PDB: d1hdya1, d1hdyb1

Details for d1hdya2

PDB Entry: 1hdy, 2.5 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences

SCOP Domain Sequences for d1hdya2:

Sequence; same for both SEQRES and ATOM records:

>d1hdya2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
asplekvcligcgfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiav
dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllcc
heacgtsvivgvppasqnlsinpmllltgrtwkgavyggfkskegipklvadfmak

Timeline for d1hdya2:

• d1hdya2 first appeared (with stable ids) in SCOP 1.55
  
• d1hdya2 appears in SCOP 1.63
  
• d1hdya2 appears in SCOP 1.67
  
• d1hdya2 appears in the current release, SCOPe 2.08