SCOP 1.65: Domain d1d1td2: 1d1t D:163-338

Lineage for d1d1td2 (1d1t D:163-338)

Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (8 proteins)
N-terminal all-beta domain defines family
Protein Alcohol dehydrogenase [51737] (6 species)
Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (18 PDB entries)
Domain d1d1td2: 1d1t D:163-338 [29738]
Other proteins in same PDB: d1d1ta1, d1d1tb1, d1d1tc1, d1d1td1
sigma isozyme
complexed with act, cac, nad, zn; mutant

Details for d1d1td2

PDB Entry: 1d1t (more details), 2.4 Å

PDB Description: mutant of human sigma alcohol dehydrogenase with leucine at position 141

SCOP Domain Sequences for d1d1td2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1td2 c.2.1.1 (D:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
aappekvcligcgfstgygaavktgkvkpgstcvvfglggvglsvimgcksagasriigi
dlnkdkfekamavgatecispkdstkpisevlsemtgnnvgytfevighletmidalasc
hmnygtsvvvgvppsakmltydpmllftgrtwkgcvfgglksrddvpklvteflak

SCOP Domain Coordinates for d1d1td2:

Click to download the PDB-style file with coordinates for d1d1td2.
(The format of our PDB-style files is described here.)

Timeline for d1d1td2: