SCOPe 2.03: Domain d1hdxb2: 1hdx B:163-338

Lineage for d1hdxb2 (1hdx B:163-338)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries)
   Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327

8. Domain d1hdxb2: 1hdx B:163-338 [29734]
   Other proteins in same PDB: d1hdxa1, d1hdxb1
   complexed with cl, cxl, nad, zn

Details for d1hdxb2

PDB Entry: 1hdx, 2.5 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences

PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d1hdxb2:

Sequence; same for both SEQRES and ATOM records:

>d1hdxb2 c.2.1.1 (B:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
asplekvcligcgfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiav
dinkdkfakakelgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllcc
heacgtsvivgvppasqnlsinpmllltgrtwkgavyggfkskegipklvadfmak

Timeline for d1hdxb2:

• d1hdxb2 first appeared (with stable ids) in SCOP 1.55
  
• d1hdxb2 appears in SCOPe 2.02
  
• d1hdxb2 appears in SCOPe 2.04
  
• d1hdxb2 appears in the current release, SCOPe 2.08