SCOP 1.59: Domain d1hdxa2: 1hdx A:175-324

Lineage for d1hdxa2 (1hdx A:175-324)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)

6. Protein Alcohol dehydrogenase [51737] (4 species)

7. Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (13 PDB entries)

8. Domain d1hdxa2: 1hdx A:175-324 [29733]
   Other proteins in same PDB: d1hdxa1, d1hdxb1

Details for d1hdxa2

PDB Entry: 1hdx, 2.5 Å

PDB Description: three-dimensional structures of three human alcohol dehydrogenase variants: correlations with their functional differences

SCOP Domain Sequences for d1hdxa2:

Sequence; same for both SEQRES and ATOM records:

>d1hdxa2 c.2.1.1 (A:175-324) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakake
lgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgv
ppasqnlsinpmllltgrtwkgavyggfks

Timeline for d1hdxa2:

• d1hdxa2 first appeared (with stable ids) in SCOP 1.55
  
• d1hdxa2 appears in SCOP 1.57
  
• d1hdxa2 appears in SCOP 1.61
  
• d1hdxa2 appears in the current release, SCOPe 2.08