Lineage for d1htbb2 (1htb B:175-324)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 117974Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 117975Protein Alcohol dehydrogenase [51737] (4 species)
  7. 118034Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (13 PDB entries)
  8. 118042Domain d1htbb2: 1htb B:175-324 [29732]
    Other proteins in same PDB: d1htba1, d1htbb1

Details for d1htbb2

PDB Entry: 1htb (more details), 2.4 Å

PDB Description: crystallization of human beta3 alcohol dehydrogenase (10 mg/ml) in 100 mm sodium phosphate (ph 7.5), 7.5 mm nad+ and 1 mm 4-iodopyrazole at 25 c

SCOP Domain Sequences for d1htbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htbb2 c.2.1.1 (B:175-324) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakake
lgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgv
ppasqnlsinpmllltgrtwkgavyggfks

SCOP Domain Coordinates for d1htbb2:

Click to download the PDB-style file with coordinates for d1htbb2.
(The format of our PDB-style files is described here.)

Timeline for d1htbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1htbb1