Lineage for d1hsza2 (1hsz A:175-324)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 175017Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 175018Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 175019Family c.2.1.1: Alcohol/glucose dehydrogenases, C-terminal domain [51736] (5 proteins)
  6. 175020Protein Alcohol dehydrogenase [51737] (4 species)
  7. 175079Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (16 PDB entries)
  8. 175084Domain d1hsza2: 1hsz A:175-324 [29727]
    Other proteins in same PDB: d1hsza1, d1hszb1

Details for d1hsza2

PDB Entry: 1hsz (more details), 2.2 Å

PDB Description: human beta-1 alcohol dehydrogenase (adh1b*1)

SCOP Domain Sequences for d1hsza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hsza2 c.2.1.1 (A:175-324) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gfstgygsavnvakvtpgstcavfglggvglsavmgckaagaariiavdinkdkfakake
lgatecinpqdykkpiqevlkemtdggvdfsfevigrldtmmasllccheacgtsvivgv
ppasqnlsinpmllltgrtwkgavyggfks

SCOP Domain Coordinates for d1hsza2:

Click to download the PDB-style file with coordinates for d1hsza2.
(The format of our PDB-style files is described here.)

Timeline for d1hsza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hsza1